SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1wxwc2 (1wxw C:65-382)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130452Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 protein domains)
    C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam PF05958)
  6. 2130461Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species)
  7. 2130462Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries)
    Uniprot Q5SIT4 65-382
  8. 2130469Domain d1wxwc2: 1wxw C:65-382 [121415]
    Other proteins in same PDB: d1wxwa1, d1wxwb1, d1wxwc1, d1wxwd1
    automated match to d1wxwa2
    complexed with hez

Details for d1wxwc2

PDB Entry: 1wxw (more details), 2.55 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8
PDB Compounds: (C:) hypothetical protein TTHA1280

SCOPe Domain Sequences for d1wxwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxwc2 c.66.1.51 (C:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal
rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray
kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv
llnhpethylkfavfqvl

SCOPe Domain Coordinates for d1wxwc2:

Click to download the PDB-style file with coordinates for d1wxwc2.
(The format of our PDB-style files is described here.)

Timeline for d1wxwc2: