Lineage for d1wxma1 (1wxm A:8-80)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018205Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 1018206Protein A-Raf proto-oncogene serine/threonine-protein kinase [142968] (1 species)
  7. 1018207Species Human (Homo sapiens) [TaxId:9606] [142969] (1 PDB entry)
    Uniprot P10398 19-91
  8. 1018208Domain d1wxma1: 1wxm A:8-80 [121402]

Details for d1wxma1

PDB Entry: 1wxm (more details)

PDB Description: solution structure of the n-terminal ras-binding domain (rbd) in human a-raf kinase
PDB Compounds: (A:) A-Raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d1wxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]}
gtvkvylpnkqrtvvtvrdgmsvydsldkalkvrglnqdccvvyrlikgrktvtawdtai
apldgeelivevl

SCOPe Domain Coordinates for d1wxma1:

Click to download the PDB-style file with coordinates for d1wxma1.
(The format of our PDB-style files is described here.)

Timeline for d1wxma1: