Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) |
Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins) contains Pfam PF00788 and Pfam 02196 |
Protein A-Raf proto-oncogene serine/threonine-protein kinase [142968] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142969] (1 PDB entry) |
Domain d1wxma1: 1wxm A:8-80 [121402] |
PDB Entry: 1wxm (more details)
SCOP Domain Sequences for d1wxma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} gtvkvylpnkqrtvvtvrdgmsvydsldkalkvrglnqdccvvyrlikgrktvtawdtai apldgeelivevl
Timeline for d1wxma1: