Lineage for d1wxma1 (1wxm A:8-80)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717441Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins)
    contains Pfam PF00788 and Pfam 02196
  6. 717442Protein A-Raf proto-oncogene serine/threonine-protein kinase [142968] (1 species)
  7. 717443Species Human (Homo sapiens) [TaxId:9606] [142969] (1 PDB entry)
  8. 717444Domain d1wxma1: 1wxm A:8-80 [121402]

Details for d1wxma1

PDB Entry: 1wxm (more details)

PDB Description: solution structure of the n-terminal ras-binding domain (rbd) in human a-raf kinase
PDB Compounds: (A:) A-Raf proto-oncogene serine/threonine-protein kinase

SCOP Domain Sequences for d1wxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]}
gtvkvylpnkqrtvvtvrdgmsvydsldkalkvrglnqdccvvyrlikgrktvtawdtai
apldgeelivevl

SCOP Domain Coordinates for d1wxma1:

Click to download the PDB-style file with coordinates for d1wxma1.
(The format of our PDB-style files is described here.)

Timeline for d1wxma1: