Lineage for d1wx7a1 (1wx7 A:8-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931510Protein Ubiquilin-3 [142946] (1 species)
  7. 2931511Species Human (Homo sapiens) [TaxId:9606] [142947] (2 PDB entries)
    Uniprot Q9H347 11-104! Uniprot Q9H347 15-98
  8. 2931513Domain d1wx7a1: 1wx7 A:8-100 [121392]
    Other proteins in same PDB: d1wx7a2, d1wx7a3

Details for d1wx7a1

PDB Entry: 1wx7 (more details)

PDB Description: solution structure of the n-terminal ubiquitin-like domain in the human ubiquilin 3 (ubqln3)
PDB Compounds: (A:) Ubiquilin 3

SCOPe Domain Sequences for d1wx7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wx7a1 d.15.1.1 (A:8-100) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}
spapvqdphlikvtvktpkdkedfsvtdtctiqqlkeeisqrfkahpdqlvlifagkilk
dpdslaqcgvrdgltvhlvikrqhramgnecpa

SCOPe Domain Coordinates for d1wx7a1:

Click to download the PDB-style file with coordinates for d1wx7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wx7a1: