PDB entry 1wx7

View 1wx7 on RCSB PDB site
Description: Solution Structure of the N-terminal Ubiquitin-like Domain in the Human Ubiquilin 3 (UBQLN3)
Class: structural genomics, unknown function
Keywords: human ubiquilin 3 (UBQLN3), ubiquitin-like domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-01-20, released 2005-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquilin 3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBQLN3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H347 (7-99)
      • cloning artifact (0-6)
      • cloning artifact (100-105)
    Domains in SCOPe 2.08: d1wx7a1, d1wx7a2, d1wx7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wx7A (A:)
gssgssgspapvqdphlikvtvktpkdkedfsvtdtctiqqlkeeisqrfkahpdqlvli
fagkilkdpdslaqcgvrdgltvhlvikrqhramgnecpasgpssg