Lineage for d1wx0d1 (1wx0 D:1-211)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 683990Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (3 species)
    forms helix-swapped pentamers
  7. 684023Species Thermus thermophilus [TaxId:274] [141836] (1 PDB entry)
    clear orthologue of the E.coli protein; annotated as transaldolase in UniProt
  8. 684027Domain d1wx0d1: 1wx0 D:1-211 [121385]
    automatically matched to 1WX0 A:1-211

Details for d1wx0d1

PDB Entry: 1wx0 (more details), 2.27 Å

PDB Description: Crystal structure of transaldolase from Thermus thermophilus HB8
PDB Compounds: (D:) Transaldolase

SCOP Domain Sequences for d1wx0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wx0d1 c.1.10.1 (D:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]}
melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
teaallgadiatmphavfkqllkhpltdigl

SCOP Domain Coordinates for d1wx0d1:

Click to download the PDB-style file with coordinates for d1wx0d1.
(The format of our PDB-style files is described here.)

Timeline for d1wx0d1: