Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (3 species) forms helix-swapped pentamers |
Species Thermus thermophilus [TaxId:274] [141836] (1 PDB entry) clear orthologue of the E.coli protein; annotated as transaldolase in UniProt |
Domain d1wx0d1: 1wx0 D:1-211 [121385] automatically matched to 1WX0 A:1-211 |
PDB Entry: 1wx0 (more details), 2.27 Å
SCOP Domain Sequences for d1wx0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wx0d1 c.1.10.1 (D:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]} melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv teaallgadiatmphavfkqllkhpltdigl
Timeline for d1wx0d1: