Lineage for d1wx0d_ (1wx0 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836712Species Thermus thermophilus HB8 [TaxId:300852] [186838] (2 PDB entries)
  8. 2836716Domain d1wx0d_: 1wx0 D: [121385]
    Other proteins in same PDB: d1wx0a1
    automated match to d1vpxa_

Details for d1wx0d_

PDB Entry: 1wx0 (more details), 2.27 Å

PDB Description: Crystal structure of transaldolase from Thermus thermophilus HB8
PDB Compounds: (D:) Transaldolase

SCOPe Domain Sequences for d1wx0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wx0d_ c.1.10.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
teaallgadiatmphavfkqllkhpltdigl

SCOPe Domain Coordinates for d1wx0d_:

Click to download the PDB-style file with coordinates for d1wx0d_.
(The format of our PDB-style files is described here.)

Timeline for d1wx0d_: