![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein PH1933 [143648] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [143649] (1 PDB entry) Uniprot O59596 1-157 |
![]() | Domain d1wwzb1: 1wwz B:3-157 [121381] automatically matched to 1WWZ A:1-157 complexed with aco |
PDB Entry: 1wwz (more details), 1.75 Å
SCOPe Domain Sequences for d1wwzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwzb1 d.108.1.1 (B:3-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} eikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffvakv gdkivgfivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndtie lwvgeknygamnlyekfgfkkvgksgiwvrmikrq
Timeline for d1wwzb1: