SCOPe 2.08: Domain d1wwzb_: 1wwz B:

Lineage for d1wwzb_ (1wwz B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein PH1933 [143648] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143649] (1 PDB entry)
   Uniprot O59596 1-157

8. Domain d1wwzb_: 1wwz B: [121381]
   automated match to d1wwza1
   complexed with aco

Details for d1wwzb_

PDB Entry: 1wwz, 1.75 Å

PDB Description: Crystal structure of PH1933 from Pyrococcus horikoshii OT3

PDB Compounds: (B:) hypothetical protein PH1933

SCOPe Domain Sequences for d1wwzb_:

Sequence; same for both SEQRES and ATOM records:

>d1wwzb_ d.108.1.1 (B:) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}
eikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffvakv
gdkivgfivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndtie
lwvgeknygamnlyekfgfkkvgksgiwvrmikrqnl

Timeline for d1wwzb_:

• d1wwzb_ first appeared in SCOP 1.73, called d1wwzb1
  
• d1wwzb_ appears in SCOPe 2.07