Lineage for d1wwza1 (1wwz A:1-157)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533371Protein Hypothetical protein PH1933 [143648] (1 species)
  7. 2533372Species Pyrococcus horikoshii [TaxId:53953] [143649] (1 PDB entry)
    Uniprot O59596 1-157
  8. 2533373Domain d1wwza1: 1wwz A:1-157 [121380]
    complexed with aco

Details for d1wwza1

PDB Entry: 1wwz (more details), 1.75 Å

PDB Description: Crystal structure of PH1933 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH1933

SCOPe Domain Sequences for d1wwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}
mdeikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffva
kvgdkivgfivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndt
ielwvgeknygamnlyekfgfkkvgksgiwvrmikrq

SCOPe Domain Coordinates for d1wwza1:

Click to download the PDB-style file with coordinates for d1wwza1.
(The format of our PDB-style files is described here.)

Timeline for d1wwza1: