Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Nucleoporin 35 [143330] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [143331] (1 PDB entry) Uniprot Q8R4R6 169-249 |
Domain d1wwhb1: 1wwh B:171-249 [121359] automatically matched to 1WWH A:169-249 |
PDB Entry: 1wwh (more details), 2.7 Å
SCOPe Domain Sequences for d1wwhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwhb1 d.58.7.1 (B:171-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} ddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgri fgesimigvkpcidknvme
Timeline for d1wwhb1: