Lineage for d1wwhb1 (1wwh B:171-249)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028125Protein Nucleoporin 35 [143330] (1 species)
  7. 1028126Species Mouse (Mus musculus) [TaxId:10090] [143331] (1 PDB entry)
    Uniprot Q8R4R6 169-249
  8. 1028128Domain d1wwhb1: 1wwh B:171-249 [121359]
    automatically matched to 1WWH A:169-249

Details for d1wwhb1

PDB Entry: 1wwh (more details), 2.7 Å

PDB Description: Crystal structure of the MPPN domain of mouse Nup35
PDB Compounds: (B:) nucleoporin 35

SCOPe Domain Sequences for d1wwhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwhb1 d.58.7.1 (B:171-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}
ddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgri
fgesimigvkpcidknvme

SCOPe Domain Coordinates for d1wwhb1:

Click to download the PDB-style file with coordinates for d1wwhb1.
(The format of our PDB-style files is described here.)

Timeline for d1wwhb1: