SCOP 1.73: Domain d1wwhb1: 1wwh B:171-249

Lineage for d1wwhb1 (1wwh B:171-249)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Nucleoporin 35 [143330] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143331] (1 PDB entry)

8. Domain d1wwhb1: 1wwh B:171-249 [121359]
   automatically matched to 1WWH A:169-249

Details for d1wwhb1

PDB Entry: 1wwh, 2.7 Å

PDB Description: Crystal structure of the MPPN domain of mouse Nup35

PDB Compounds: (B:) nucleoporin 35

SCOP Domain Sequences for d1wwhb1:

Sequence; same for both SEQRES and ATOM records:

>d1wwhb1 d.58.7.1 (B:171-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}
ddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgri
fgesimigvkpcidknvme

Timeline for d1wwhb1:

• d1wwhb1 is new in SCOP 1.73
  
• d1wwhb1 appears in SCOP 1.75
  
• d1wwhb1 appears in the current release, SCOPe 2.08, called d1wwhb_