Lineage for d1wunt1 (1wun T:6-108)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029473Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2029474Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
    Uniprot P13726 33-242
  8. 2029504Domain d1wunt1: 1wun T:6-108 [121302]
    Other proteins in same PDB: d1wunh_, d1wunl1, d1wunl2, d1wunl3
    automatically matched to d1a21a1
    complexed with bgc, ca, fuc, p5b

Details for d1wunt1

PDB Entry: 1wun (more details), 2.4 Å

PDB Description: Human Factor Viia-Tissue Factor Complexed with ethylsulfonamide-D-Trp-Gln-p-aminobenzamidine
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1wunt1:

Sequence, based on SEQRES records: (download)

>d1wunt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records): (download)

>d1wunt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypeplyenspeftpyletnl

SCOPe Domain Coordinates for d1wunt1:

Click to download the PDB-style file with coordinates for d1wunt1.
(The format of our PDB-style files is described here.)

Timeline for d1wunt1: