![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Coagulation factor VIIa [57201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
![]() | Domain d1wunl2: 1wun L:87-142 [121300] Other proteins in same PDB: d1wunh_, d1wunl3, d1wunt1, d1wunt2 automated match to d1danl2 complexed with bgc, ca, fuc, p5b |
PDB Entry: 1wun (more details), 2.4 Å
SCOPe Domain Sequences for d1wunl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wunl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d1wunl2: