SCOPe 2.07: Domain d1wrfa_: 1wrf A:

Lineage for d1wrfa_ (1wrf A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (3 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products
   automatically mapped to Pfam PF02221

6. Protein Major mite allergen [49256] (2 species)
   contains additional N-terminal strand

7. Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
   Uniprot Q00855 18-146

8. Domain d1wrfa_: 1wrf A: [121195]
   automated match to d2f08a_

Details for d1wrfa_

PDB Entry: 1wrf

PDB Description: refined solution structure of der f 2, the major mite allergen from dermatophagoides farinae

PDB Compounds: (A:) Mite group 2 allergen Der f 2

SCOPe Domain Sequences for d1wrfa_:

Sequence; same for both SEQRES and ATOM records:

>d1wrfa_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

Timeline for d1wrfa_:

• d1wrfa_ first appeared in SCOP 1.73, called d1wrfa1
  
• d1wrfa_ appears in SCOPe 2.06
  
• d1wrfa_ appears in the current release, SCOPe 2.08