Lineage for d1wrfa1 (1wrf A:1-129)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658989Family b.1.18.7: ML domain [81287] (2 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
  6. 658993Protein Major mite allergen [49256] (2 species)
    contains additional N-terminal strand
  7. 658994Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
  8. 659001Domain d1wrfa1: 1wrf A:1-129 [121195]
    automatically matched to d1ahk__

Details for d1wrfa1

PDB Entry: 1wrf (more details)

PDB Description: refined solution structure of der f 2, the major mite allergen from dermatophagoides farinae
PDB Compounds: (A:) Mite group 2 allergen Der f 2

SCOP Domain Sequences for d1wrfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrfa1 b.1.18.7 (A:1-129) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

SCOP Domain Coordinates for d1wrfa1:

Click to download the PDB-style file with coordinates for d1wrfa1.
(The format of our PDB-style files is described here.)

Timeline for d1wrfa1: