SCOPe 2.08: Domain d1wqji_: 1wqj I:

Lineage for d1wqji_ (1wqj I:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d1wqji_: 1wqj I: [121169]
   Other proteins in same PDB: d1wqjb1
   automated match to d1bqt__

Details for d1wqji_

PDB Entry: 1wqj, 1.6 Å

PDB Description: structural basis for the regulation of insulin-like growth factors (igfs) by igf binding proteins (igfbps)

PDB Compounds: (I:) Insulin-like growth factor IB

SCOPe Domain Sequences for d1wqji_:

Sequence; same for both SEQRES and ATOM records:

>d1wqji_ g.1.1.1 (I:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
ap

Timeline for d1wqji_:

• d1wqji_ first appeared in SCOP 1.73, called d1wqji1
  
• d1wqji_ appears in SCOPe 2.07