Lineage for d1wqji1 (1wqj I:2-63)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 746752Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 746753Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 746754Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 746974Protein Insulin-like growth factor [57002] (1 species)
  7. 746975Species Human (Homo sapiens) [TaxId:9606] [57003] (18 PDB entries)
  8. 746976Domain d1wqji1: 1wqj I:2-63 [121169]
    automatically matched to d1bqt__

Details for d1wqji1

PDB Entry: 1wqj (more details), 1.6 Å

PDB Description: structural basis for the regulation of insulin-like growth factors (igfs) by igf binding proteins (igfbps)
PDB Compounds: (I:) Insulin-like growth factor IB

SCOP Domain Sequences for d1wqji1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqji1 g.1.1.1 (I:2-63) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
ap

SCOP Domain Coordinates for d1wqji1:

Click to download the PDB-style file with coordinates for d1wqji1.
(The format of our PDB-style files is described here.)

Timeline for d1wqji1: