SCOPe 2.07: Domain d1wpxa_: 1wpx A:

Lineage for d1wpxa_ (1wpx A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins)
   automatically mapped to Pfam PF00450

6. Protein automated matches [190105] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186829] (1 PDB entry)

8. Domain d1wpxa_: 1wpx A: [121156]
   Other proteins in same PDB: d1wpxb1
   automated match to d1cpy__
   complexed with nag, ndg, so4

Details for d1wpxa_

PDB Entry: 1wpx, 2.7 Å

PDB Description: crystal structure of carboxypeptidase y inhibitor complexed with the cognate proteinase

PDB Compounds: (A:) Carboxypeptidase Y

SCOPe Domain Sequences for d1wpxa_:

Sequence; same for both SEQRES and ATOM records:

>d1wpxa_ c.69.1.5 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kikdpkilgidpnvtqytgyldvededkhfffwtfesrndpakdpvilwlnggpgcsslt
glffelgpssigpdlkpignpyswnsnatvifldqpvnvgfsysgssgvsntvaagkdvy
nflelffdqfpeyvnkgqdfhiagesyaghyipvfaseilshkdrnfnltsvligngltd
pltqynyyepmacgeggepsvlpseecsamedslerclgliescydsqsvwscvpatiyc
nnaqlapyqrtgrnvydirkdceggnlcyptlqdiddylnqdyvkeavgaevdhyescnf
dinrnflfagdwmkpyhtavtdllnqdlpilvyagdkdficnwlgnkawtdvlpwkydee
fasqkvrnwtasitdevagevksykhftylrvfngghmvpfdvpenalsmvnewihggfs
l

Timeline for d1wpxa_:

• d1wpxa_ first appeared in SCOP 1.73, called d1wpxa1
  
• d1wpxa_ appears in SCOPe 2.06
  
• d1wpxa_ appears in the current release, SCOPe 2.08