Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species) forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively |
Species Thermus thermophilus [TaxId:274] [101358] (2 PDB entries) structural genomics |
Domain d1wp4c1: 1wp4 C:158-289 [121139] Other proteins in same PDB: d1wp4a2, d1wp4b2, d1wp4c2, d1wp4d2 automatically matched to d1j3va1 complexed with ndp, so4 |
PDB Entry: 1wp4 (more details), 2 Å
SCOPe Domain Sequences for d1wp4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wp4c1 a.100.1.1 (C:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} vgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrsnatenlipqr vltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhveal rllerwggveir
Timeline for d1wp4c1: