| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.13: RelB-like [141004] (2 families) ![]() wraps around RelE subunit |
| Family a.137.13.1: RelB-like [141005] (1 protein) |
| Protein Hypothetical protein PHS014 [141006] (1 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [141007] (1 PDB entry) Uniprot O73967 7-67 |
| Domain d1wmib1: 1wmi B:7-67 [121046] Other proteins in same PDB: d1wmia1, d1wmic_, d1wmid_ |
PDB Entry: 1wmi (more details), 2.3 Å
SCOPe Domain Sequences for d1wmib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmib1 a.137.13.1 (B:7-67) Hypothetical protein PHS014 {Pyrococcus horikoshii [TaxId: 53953]}
gdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidaeelpepe
d
Timeline for d1wmib1: