SCOPe 2.04: Domain d1wlzb_: 1wlz B:

Lineage for d1wlzb_ (1wlz B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein automated matches [190808] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188079] (1 PDB entry)

8. Domain d1wlzb_: 1wlz B: [121025]
   Other proteins in same PDB: d1wlza1
   automated match to d1wlza1

Details for d1wlzb_

PDB Entry: 1wlz, 1.6 Å

PDB Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis

PDB Compounds: (B:) CAP-binding protein complex interacting protein 1 isoform a

SCOPe Domain Sequences for d1wlzb_:

Sequence; same for both SEQRES and ATOM records:

>d1wlzb_ a.39.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqf
drlwnempvnakgrlkypdflsrf

Timeline for d1wlzb_:

• d1wlzb_ first appeared in SCOP 1.73, called d1wlzb1
  
• d1wlzb_ appears in SCOPe 2.03
  
• d1wlzb_ appears in SCOPe 2.05
  
• d1wlzb_ appears in the current release, SCOPe 2.08, called d1wlzb2