Lineage for d1wlta1 (1wlt A:1-176)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138045Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1138046Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 1138047Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 1138086Species Sulfolobus tokodaii [TaxId:111955] [141586] (2 PDB entries)
    Uniprot Q96Z62 1-176
  8. 1138087Domain d1wlta1: 1wlt A:1-176 [121013]

Details for d1wlta1

PDB Entry: 1wlt (more details), 1.9 Å

PDB Description: Crystal Structure of dTDP-4-dehydrorhamnose 3,5-epimerase homologue from Sulfolobus tokodaii
PDB Compounds: (A:) 176aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d1wlta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Sulfolobus tokodaii [TaxId: 111955]}
mpfefenlgmgiilikpkvfpdkrgfflevfksedftkmripnviqtnmsfsrkgvvrgl
hyqrtpkeqgkiifvpkgrildvavdvrkssptfgkyvkaelneenhymlwippgfahgf
qaledsiviyfithneyspphercisysyidwpikeviisdkdlqcpslekaevfd

SCOPe Domain Coordinates for d1wlta1:

Click to download the PDB-style file with coordinates for d1wlta1.
(The format of our PDB-style files is described here.)

Timeline for d1wlta1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wltb1