SCOPe 2.08: Domain d1wlta1: 1wlt A:1-176

Lineage for d1wlta1 (1wlt A:1-176)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Sulfolobus tokodaii [TaxId:111955] [141586] (2 PDB entries)
   Uniprot Q96Z62 1-176

8. Domain d1wlta1: 1wlt A:1-176 [121013]

Details for d1wlta1

PDB Entry: 1wlt, 1.9 Å

PDB Description: Crystal Structure of dTDP-4-dehydrorhamnose 3,5-epimerase homologue from Sulfolobus tokodaii

PDB Compounds: (A:) 176aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d1wlta1:

Sequence; same for both SEQRES and ATOM records:

>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Sulfolobus tokodaii [TaxId: 111955]}
mpfefenlgmgiilikpkvfpdkrgfflevfksedftkmripnviqtnmsfsrkgvvrgl
hyqrtpkeqgkiifvpkgrildvavdvrkssptfgkyvkaelneenhymlwippgfahgf
qaledsiviyfithneyspphercisysyidwpikeviisdkdlqcpslekaevfd

Timeline for d1wlta1:

• d1wlta1 first appeared in SCOP 1.73
  
• d1wlta1 appears in SCOPe 2.07