Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186823] (3 PDB entries) |
Domain d1wg0a2: 1wg0 A:1-228 [120971] Other proteins in same PDB: d1wg0a3 automated match to d1ixva_ applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1wg0 (more details), 2.53 Å
SCOPe Domain Sequences for d1wg0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wg0a2 d.211.1.1 (A:1-228) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
Timeline for d1wg0a2: