SCOPe 2.08: Domain d1wcba1: 1wcb A:1-107

Lineage for d1wcba1 (1wcb A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d1wcba1: 1wcb A:1-107 [120882]
   Other proteins in same PDB: d1wcba2, d1wcbb1, d1wcbb2, d1wcbh1, d1wcbh2, d1wcbl2
   automated match to d1a5fl1
   complexed with iod, pe1

Details for d1wcba1

PDB Entry: 1wcb, 2.5 Å

PDB Description: plp-dependent catalytic antibody 15a9 in complex with its hapten

PDB Compounds: (A:) fab fragment of catalytic antibody 15a9, light chain

SCOPe Domain Sequences for d1wcba1:

Sequence; same for both SEQRES and ATOM records:

>d1wcba1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

Timeline for d1wcba1:

• d1wcba1 first appeared in SCOP 1.73
  
• d1wcba1 appears in SCOPe 2.07