PDB entry 1wcb

View 1wcb on RCSB PDB site
Description: plp-dependent catalytic antibody 15a9 in complex with its hapten
Class: immune system
Keywords: catalytic antibody, transamination, pyridoxal-phosphate, hapten, phosphopyridoxyl-l-lysine, immune system
Deposited on 2004-11-12, released 2006-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab fragment of catalytic antibody 15a9, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1WCB (27-212)
    Domains in SCOPe 2.07: d1wcba1, d1wcba2
  • Chain 'B':
    Compound: fab fragment of catalytic antibody 15a9, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Domains in SCOPe 2.07: d1wcbb1, d1wcbb2
  • Chain 'H':
    Compound: fab fragment of catalytic antibody 15a9, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Domains in SCOPe 2.07: d1wcbh1, d1wcbh2
  • Chain 'L':
    Compound: fab fragment of catalytic antibody 15a9, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1WCB (27-212)
    Domains in SCOPe 2.07: d1wcbl1, d1wcbl2
  • Heterogens: PE1, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wcbA (A:)
    dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wcbB (B:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcbB (B:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wcbH (H:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcbH (H:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wcbL (L:)
    dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec