Lineage for d1wcbl2 (1wcb L:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753102Domain d1wcbl2: 1wcb L:108-214 [120885]
    Other proteins in same PDB: d1wcba1, d1wcbb1, d1wcbb2, d1wcbh1, d1wcbh2, d1wcbl1
    automated match to d1tqbc2
    complexed with iod, pe1

Details for d1wcbl2

PDB Entry: 1wcb (more details), 2.5 Å

PDB Description: plp-dependent catalytic antibody 15a9 in complex with its hapten
PDB Compounds: (L:) fab fragment of catalytic antibody 15a9, light chain

SCOPe Domain Sequences for d1wcbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcbl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1wcbl2:

Click to download the PDB-style file with coordinates for d1wcbl2.
(The format of our PDB-style files is described here.)

Timeline for d1wcbl2: