SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1wb9a2 (1wb9 A:567-800)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2112854Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 2112855Species Escherichia coli [TaxId:562] [52699] (8 PDB entries)
    Uniprot P23909 2-800
  8. 2112856Domain d1wb9a2: 1wb9 A:567-800 [120834]
    Other proteins in same PDB: d1wb9a1, d1wb9a3, d1wb9a4
    automatically matched to d1e3ma2
    protein/DNA complex; complexed with adp, mg; mutant

Details for d1wb9a2

PDB Entry: 1wb9 (more details), 2.1 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38t mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wb9a2:

Sequence, based on SEQRES records: (download)

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records): (download)

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgfmvemtetanilhnateyslvlmdeigr
gtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtia
fmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

SCOPe Domain Coordinates for d1wb9a2:

Click to download the PDB-style file with coordinates for d1wb9a2.
(The format of our PDB-style files is described here.)

Timeline for d1wb9a2: