SCOPe 2.07: Domain d1w9ga_: 1w9g A:

Lineage for d1w9ga_ (1w9g A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.330: ERH-like [143874] (1 superfamily)
   beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10

4. Superfamily d.330.1: ERH-like [143875] (1 family)
   automatically mapped to Pfam PF01133

5. Family d.330.1.1: ERH-like [143876] (2 proteins)
   Pfam PF01133

6. Protein Enhancer of rudimentary homolog, ERH [143877] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143878] (5 PDB entries)
   Uniprot P84089 1-104! Uniprot P84090 2-101
   also includes 100% identical human protein P84090 (1W9G)

8. Domain d1w9ga_: 1w9g A: [120783]
   automated match to d1wwqa1

Details for d1w9ga_

PDB Entry: 1w9g, 2 Å

PDB Description: structure of erh (enhencer of rudimentary gene)

PDB Compounds: (A:) Enhancer of rudimentary homolog

SCOPe Domain Sequences for d1w9ga_:

Sequence; same for both SEQRES and ATOM records:

>d1w9ga_ d.330.1.1 (A:) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqag

Timeline for d1w9ga_:

• d1w9ga_ first appeared in SCOP 1.73, called d1w9ga1
  
• d1w9ga_ appears in SCOPe 2.06
  
• d1w9ga_ appears in the current release, SCOPe 2.08