Lineage for d1w9gb_ (1w9g B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616919Fold d.330: ERH-like [143874] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10
  4. 2616920Superfamily d.330.1: ERH-like [143875] (1 family) (S)
    automatically mapped to Pfam PF01133
  5. 2616921Family d.330.1.1: ERH-like [143876] (2 proteins)
    Pfam PF01133
  6. 2616922Protein Enhancer of rudimentary homolog, ERH [143877] (1 species)
  7. 2616923Species Mouse (Mus musculus) [TaxId:10090] [143878] (5 PDB entries)
    Uniprot P84089 1-104! Uniprot P84090 2-101
    also includes 100% identical human protein P84090 (1W9G)
  8. 2616928Domain d1w9gb_: 1w9g B: [120784]
    automated match to d1wwqa1

Details for d1w9gb_

PDB Entry: 1w9g (more details), 2 Å

PDB Description: structure of erh (enhencer of rudimentary gene)
PDB Compounds: (B:) Enhancer of rudimentary homolog

SCOPe Domain Sequences for d1w9gb_:

Sequence, based on SEQRES records: (download)

>d1w9gb_ d.330.1.1 (B:) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqag

Sequence, based on observed residues (ATOM records): (download)

>d1w9gb_ d.330.1.1 (B:) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnstydisqlfdfidd
ladlsclvyradtqtyqpynkdwikekiyvllrrqaqqag

SCOPe Domain Coordinates for d1w9gb_:

Click to download the PDB-style file with coordinates for d1w9gb_.
(The format of our PDB-style files is described here.)

Timeline for d1w9gb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w9ga_