![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein Aminopeptidase P, C-terminal domain [55928] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55929] (20 PDB entries) |
![]() | Domain d1w7vb2: 1w7v B:177-439 [120694] Other proteins in same PDB: d1w7va1, d1w7vb1, d1w7vc1, d1w7vd1 automated match to d1n51a2 complexed with cl, mg, zn |
PDB Entry: 1w7v (more details), 2 Å
SCOPe Domain Sequences for d1w7vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7vb2 d.127.1.1 (B:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaark
Timeline for d1w7vb2: