SCOPe 2.08: Domain d1w7vb2: 1w7v B:177-439

Lineage for d1w7vb2 (1w7v B:177-439)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)

8. Domain d1w7vb2: 1w7v B:177-439 [120694]
   Other proteins in same PDB: d1w7va1, d1w7vb1, d1w7vc1, d1w7vd1
   automated match to d1n51a2
   complexed with cl, mg, zn

Details for d1w7vb2

PDB Entry: 1w7v, 2 Å

PDB Description: znmg substituted aminopeptidase p from e. coli

PDB Compounds: (B:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1w7vb2:

Sequence; same for both SEQRES and ATOM records:

>d1w7vb2 d.127.1.1 (B:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaark

Timeline for d1w7vb2:

• d1w7vb2 first appeared in SCOP 1.73
  
• d1w7vb2 appears in SCOPe 2.07