PDB entry 1w7v

View 1w7v on RCSB PDB site
Description: znmg substituted aminopeptidase p from e. coli
Class: hydrolase
Keywords: hydrolase, proline-specific peptidase, metalloenzyme, pita-bread fold, dinuclear hydrolase
Deposited on 2004-09-13, released 2005-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xaa-pro aminopeptidase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w7va1, d1w7va2
  • Chain 'B':
    Compound: xaa-pro aminopeptidase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w7vb1, d1w7vb2
  • Chain 'C':
    Compound: xaa-pro aminopeptidase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w7vc1, d1w7vc2
  • Chain 'D':
    Compound: xaa-pro aminopeptidase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w7vd1, d1w7vd2
  • Chain 'E':
    Compound: peptide val-pro-leu
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7V (Start-2)
  • Chain 'F':
    Compound: peptide val-pro-leu
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7V (Start-2)
  • Chain 'G':
    Compound: peptide val-pro-leu
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7V (Start-2)
  • Chain 'H':
    Compound: peptide val-pro-leu
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7V (Start-2)
  • Heterogens: ZN, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w7vA (A:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w7vB (B:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7vB (B:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaark
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w7vC (C:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7vC (C:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaark
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w7vD (D:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7vD (D:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaark
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.