SCOPe 2.08: Domain d1w7vc1: 1w7v C:1-176

Lineage for d1w7vc1 (1w7v C:1-176)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (20 PDB entries)

8. Domain d1w7vc1: 1w7v C:1-176 [120695]
   Other proteins in same PDB: d1w7va2, d1w7vb2, d1w7vc2, d1w7vd2
   automated match to d1n51a1
   complexed with cl, mg, zn

Details for d1w7vc1

PDB Entry: 1w7v, 2 Å

PDB Description: znmg substituted aminopeptidase p from e. coli

PDB Compounds: (C:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1w7vc1:

Sequence; same for both SEQRES and ATOM records:

>d1w7vc1 c.55.2.1 (C:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d1w7vc1:

• d1w7vc1 first appeared in SCOP 1.73
  
• d1w7vc1 appears in SCOPe 2.07