SCOPe 2.08: Domain d1w2md2: 1w2m D:177-440

Lineage for d1w2md2 (1w2m D:177-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)

8. Domain d1w2md2: 1w2m D:177-440 [120597]
   Other proteins in same PDB: d1w2ma1, d1w2mb1, d1w2mc1, d1w2md1, d1w2me1, d1w2mf1
   automated match to d1n51a2
   complexed with ca, cl, ipa

Details for d1w2md2

PDB Entry: 1w2m, 2.4 Å

PDB Description: ca-substituted form of e. coli aminopeptidase p

PDB Compounds: (D:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1w2md2:

Sequence; same for both SEQRES and ATOM records:

>d1w2md2 d.127.1.1 (D:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d1w2md2:

• d1w2md2 first appeared in SCOP 1.73
  
• d1w2md2 appears in SCOPe 2.07