Lineage for d1w2mf2 (1w2m F:177-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538139Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2538140Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2538141Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2538142Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2538143Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2538169Domain d1w2mf2: 1w2m F:177-440 [120601]
    Other proteins in same PDB: d1w2ma1, d1w2mb1, d1w2mc1, d1w2md1, d1w2me1, d1w2mf1
    automated match to d1n51a2
    complexed with ca, cl, ipa

Details for d1w2mf2

PDB Entry: 1w2m (more details), 2.4 Å

PDB Description: ca-substituted form of e. coli aminopeptidase p
PDB Compounds: (F:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1w2mf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2mf2 d.127.1.1 (F:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d1w2mf2:

Click to download the PDB-style file with coordinates for d1w2mf2.
(The format of our PDB-style files is described here.)

Timeline for d1w2mf2: