Lineage for d1w2mb1 (1w2m B:1-176)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885765Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 2885766Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)
  6. 2885767Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 2885768Species Escherichia coli [TaxId:562] [53097] (20 PDB entries)
  8. 2885782Domain d1w2mb1: 1w2m B:1-176 [120592]
    Other proteins in same PDB: d1w2ma2, d1w2mb2, d1w2mc2, d1w2md2, d1w2me2, d1w2mf2
    automated match to d1n51a1
    complexed with ca, cl, ipa

Details for d1w2mb1

PDB Entry: 1w2m (more details), 2.4 Å

PDB Description: ca-substituted form of e. coli aminopeptidase p
PDB Compounds: (B:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1w2mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2mb1 c.55.2.1 (B:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOPe Domain Coordinates for d1w2mb1:

Click to download the PDB-style file with coordinates for d1w2mb1.
(The format of our PDB-style files is described here.)

Timeline for d1w2mb1: