SCOPe 2.08: Domain d1w1a2_: 1w1a 2:

Lineage for d1w1a2_ (1w1a 2:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456

6. Protein automated matches [190086] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [186808] (3 PDB entries)

8. Domain d1w1a2_: 1w1a 2: [120576]
   automated match to d1ny1a_
   complexed with cd, gol, ndg

Details for d1w1a2_

PDB Entry: 1w1a, 2.25 Å

PDB Description: structure of bacillus subtilis pdaa in complex with nag, a family 4 carbohydrate esterase.

PDB Compounds: (2:) Probable polysaccharide deacetylase pdaA

SCOPe Domain Sequences for d1w1a2_:

Sequence; same for both SEQRES and ATOM records:

>d1w1a2_ c.6.2.3 (2:) automated matches {Bacillus subtilis [TaxId: 1423]}
vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr

Timeline for d1w1a2_:

• d1w1a2_ first appeared in SCOP 1.73, called d1w1a21
  
• d1w1a2_ appears in SCOPe 2.07