PDB entry 1w1a

View 1w1a on RCSB PDB site
Description: Structure of Bacillus subtilis PdaA in complex with NAG, a family 4 Carbohydrate esterase.
Class: hydrolase
Keywords: family 4 carbohydrate esterase, deacetylase, peptidoglycan, nodb homology domain, hydrolase, sporulation
Deposited on 2004-06-18, released 2005-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Probable polysaccharide deacetylase pdaA
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1a1_
  • Chain '2':
    Compound: Probable polysaccharide deacetylase pdaA
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1a2_
  • Heterogens: CD, GOL, NDG, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1w1a1 (1:)
    gplgsvllaggaaqaeavpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkek
    tiyltfdngyengytpkvldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsf
    hhpdlttktadqiqdeldsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvf
    wsvafvdwkinnqkgkkyaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytf
    ksiddlmfekemrlpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1a1 (1:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1w1a2 (2:)
    gplgsvllaggaaqaeavpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkek
    tiyltfdngyengytpkvldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsf
    hhpdlttktadqiqdeldsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvf
    wsvafvdwkinnqkgkkyaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytf
    ksiddlmfekemrlpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1a2 (2:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr