SCOP 1.75: Domain d1vyja1: 1vyj A:1-126

Lineage for d1vyja1 (1vyj A:1-126)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)
   Uniprot P12004

8. Domain d1vyja1: 1vyj A:1-126 [120530]
   automatically matched to d1axca1

Details for d1vyja1

PDB Entry: 1vyj, 2.8 Å

PDB Description: structural and biochemical studies of human pcna complexes provide the basis for association with cdk/cyclin and rationale for inhibitor design

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOP Domain Sequences for d1vyja1:

Sequence; same for both SEQRES and ATOM records:

>d1vyja1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Timeline for d1vyja1:

• d1vyja1 first appeared in SCOP 1.73
  
• d1vyja1 appears in SCOPe 2.01
  
• d1vyja1 appears in the current release, SCOPe 2.08