![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
![]() | Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins) duplication: consists of two domains of this fold |
![]() | Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries) Uniprot P12004 |
![]() | Domain d1vyjg2: 1vyj G:127-255 [120537] automatically matched to d1axca2 |
PDB Entry: 1vyj (more details), 2.8 Å
SCOP Domain Sequences for d1vyjg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vyjg2 d.131.1.2 (G:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh lkyylapki
Timeline for d1vyjg2: