Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins) duplication: consists of two domains of this fold |
Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries) Uniprot P12004 |
Domain d1axca1: 1axc A:1-126 [41392] |
PDB Entry: 1axc (more details), 2.6 Å
SCOP Domain Sequences for d1axca1:
Sequence, based on SEQRES records: (download)
>d1axca1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd ldveql
>d1axca1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapekvsdyemklmdld veql
Timeline for d1axca1:
View in 3D Domains from other chains: (mouse over for more information) d1axcc1, d1axcc2, d1axce1, d1axce2 |