Lineage for d1vrxa_ (1vrx A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439581Protein Endocellulase E1 [51497] (1 species)
  7. 2439582Species Acidothermus cellulolyticus [TaxId:28049] [51498] (3 PDB entries)
  8. 2439587Domain d1vrxa_: 1vrx A: [120486]
    automated match to d1c0da_
    mutant

Details for d1vrxa_

PDB Entry: 1vrx (more details), 2.4 Å

PDB Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g
PDB Compounds: (A:) endocellulase e1 from a. cellulolyticus

SCOPe Domain Sequences for d1vrxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrxa_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv

SCOPe Domain Coordinates for d1vrxa_:

Click to download the PDB-style file with coordinates for d1vrxa_.
(The format of our PDB-style files is described here.)

Timeline for d1vrxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vrxb_