SCOP 1.73: Domain d1vrgc1: 1vrg C:1-251

Lineage for d1vrgc1 (1vrg C:1-251)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [142011] (1 PDB entry)

8. Domain d1vrgc1: 1vrg C:1-251 [120462]
   automatically matched to 1VRG A:1-251
   complexed with bct, mg

Details for d1vrgc1

PDB Entry: 1vrg, 2.3 Å

PDB Description: crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution

PDB Compounds: (C:) propionyl-CoA carboxylase, beta subunit

SCOP Domain Sequences for d1vrgc1:

Sequence; same for both SEQRES and ATOM records:

>d1vrgc1 c.14.1.4 (C:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]}
mslrdkieelkkiekeieqgggpekvekqhragkltawerlellldpgtfveidkfvehr
ntyfgldkvklprdgvitgvgeingrkvavfsqdftvmggslgemhakkivklldlalkm
gipvigindsggariqegvdalagygeiflrntlasgvvpqitviagpcaggavyspalt
dfivmvdqtarmfitgpnvikavtgeeisqedlggamvhnqksgnahfladndekamslv
rtllsylpsnn

Timeline for d1vrgc1:

• d1vrgc1 is new in SCOP 1.73
  
• d1vrgc1 appears in SCOP 1.75
  
• d1vrgc1 appears in the current release, SCOPe 2.08