| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (4 families) ![]() |
| Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
| Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species) |
| Species Thermotoga maritima [TaxId:2336] [142011] (1 PDB entry) |
| Domain d1vrgc2: 1vrg C:252-515 [120463] automatically matched to 1VRG A:252-515 complexed with bct, mg |
PDB Entry: 1vrg (more details), 2.3 Å
SCOP Domain Sequences for d1vrgc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrgc2 c.14.1.4 (C:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]}
aeeppvedpdtsletpedildilpdnpnkgydvrdvikrvvdhgeffevqpyfaknivig
fariqgktvgivanqpsvlagvldidssdkaarfirfldafnipiltfvdtpgylpgvaq
ehggiirhgakllyayseatvpkitvilrkayggayiamgskhlgadmvlawpsaeiavm
gpegaaniifkreieassnpeetrrklieeykqqfanpyiaasrgyvdmvidpretrkyi
mralevcetkveyrpkkkhgnipl
Timeline for d1vrgc2: