Lineage for d1vqta1 (1vqt A:1-198)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079188Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2079265Species Thermotoga maritima [TaxId:2336] [141746] (1 PDB entry)
    Uniprot Q9WYG7 1-198
  8. 2079266Domain d1vqta1: 1vqt A:1-198 [120417]
    Other proteins in same PDB: d1vqta2
    complexed with edo

Details for d1vqta1

PDB Entry: 1vqt (more details), 2 Å

PDB Description: Crystal structure of Orotidine 5'-phosphate decarboxylase (TM0332) from Thermotoga maritima at 2.00 A resolution
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1vqta1:

Sequence, based on SEQRES records: (download)

>d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]}
mtpvlsldmedpirfidengsfevvkvghnlaihgkkifdelakrnlkiildlkfcdips
tversikswdhpaiigftvhscagyesveralsatdkhvfvvvkltsmegsledymdrie
klnklgcdfvlpgpwakalrekikgkilvpgirmevkaddqkdvvtleemkgianfavlg
reiylsenprekikrike

Sequence, based on observed residues (ATOM records): (download)

>d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]}
mtpvlsldmedpirfidengsfevvkvghnlaihgkkifdelakrnlkiildlkfcdips
tversikswdhpaiigftvhscagyesveralsatdkhvfvvvkltsmegsledymdrie
klnklgcdfvlpgpwakalrekikgkilvpgirdvvtleemkgianfavlgreiylsenp
rekikrike

SCOPe Domain Coordinates for d1vqta1:

Click to download the PDB-style file with coordinates for d1vqta1.
(The format of our PDB-style files is described here.)

Timeline for d1vqta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqta2