SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1vqmq1 (1vqm Q:1-95)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2046659Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2046660Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 protein domains)
  6. 2046661Protein Ribosomal proteins L21e [50108] (1 species)
  7. 2046662Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
    Uniprot P12734
  8. 2046668Domain d1vqmq1: 1vqm Q:1-95 [120320]
    Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
    automatically matched to d1ffkn_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqmq1

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: The structure of the transition state analogue "DAN" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d1vqmq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqmq1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d1vqmq1:

Click to download the PDB-style file with coordinates for d1vqmq1.
(The format of our PDB-style files is described here.)

Timeline for d1vqmq1: