Lineage for d1vqmx1 (1vqm X:7-88)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942215Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 2942216Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
    automatically mapped to Pfam PF01198
  5. 2942217Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 2942218Protein Ribosomal protein L31e [54577] (1 species)
  7. 2942219Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 2942232Domain d1vqmx1: 1vqm X:7-88 [120327]
    Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmy1, d1vqmz1
    automatically matched to d1ffku_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqmx1

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1vqmx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqmx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1vqmx1:

Click to download the PDB-style file with coordinates for d1vqmx1.
(The format of our PDB-style files is described here.)

Timeline for d1vqmx1: