SCOPe 2.08: Domain d1vqma1: 1vqm A:91-237

Lineage for d1vqma1 (1vqm A:91-237)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
   Uniprot P20276

8. Domain d1vqma1: 1vqm A:91-237 [120303]
   Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
   automatically matched to d1s72a1
   protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqma1

PDB Entry: 1vqm, 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (A:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1vqma1:

Sequence; same for both SEQRES and ATOM records:

>d1vqma1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

Timeline for d1vqma1:

• d1vqma1 first appeared in SCOP 1.73
  
• d1vqma1 appears in SCOPe 2.07