Lineage for d1vq9v1 (1vq9 V:1-65)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689771Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 2689772Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 2689773Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 2689814Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 2689824Domain d1vq9v1: 1vq9 V:1-65 [120238]
    Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
    automatically matched to d1ffks_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq9v1

PDB Entry: 1vq9 (more details), 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vq9v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq9v1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1vq9v1:

Click to download the PDB-style file with coordinates for d1vq9v1.
(The format of our PDB-style files is described here.)

Timeline for d1vq9v1: